PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10014371m
Common NameCARUB_v10014371mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 274aa    MW: 31478.7 Da    PI: 8.4641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10014371mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k +G g+W++ +r  g+ R++k+c++rw +yl
  Carubv10014371m 14 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding57.14.3e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++
  Carubv10014371m  67 RGNFTRDEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.094961IPR017930Myb domain
SuperFamilySSF466892.7E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.6E-151461IPR001005SANT/Myb domain
CDDcd001674.27E-91661No hitNo description
PROSITE profilePS5129428.80262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2865116IPR009057Homeodomain-like
SMARTSM007171.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667111IPR001005SANT/Myb domain
CDDcd001675.79E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009751Biological Processresponse to salicylic acid
GO:1900384Biological Processregulation of flavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRSPCCEKE HMNKGAWTKE EDERLVSYIK SHGEGCWRSL PRAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TRDEDELIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLLSKG  120
IDPSTHRAIN EAKTEEKFVK DVSFVSKFEK TEKSEDQKQS RKNLNGLSCK EEIVEYYPVV  180
VEEEMCTDLN LELKISPPWQ KQNHKERSPY TASRFYMENG TECSSETAKC QTEDSSSISY  240
SSSSVDISSS IGVGYDFLGL KTRVLDFRSL EMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATU269371e-150U26937.1 Arabidopsis thaliana clone myb7 DNA-binding protein mRNA, complete cds.
GenBankAY5195731e-150AY519573.1 Arabidopsis thaliana MYB transcription factor (At2g16720) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298307.10.0hypothetical protein CARUB_v10014371mg
SwissprotO496081e-116MYB32_ARATH; Transcription factor MYB32
TrEMBLR0I0070.0R0I007_9BRAS; Uncharacterized protein
STRINGscaffold_303957.11e-151(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-141myb domain protein 7